PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.E00964.1.p
Common NameMIMGU_mgv1a026093mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 185aa    MW: 20319.9 Da    PI: 4.8399
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.E00964.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB113.89.4e-36186893
             NF-YB  8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
                      +P +n++rim+ v+P + ki++dake +q cvsefi f+t+ea+++c+r+ rkt++++d+l a+ +lGf dy+epl v+l+k+r  
  Migut.E00964.1.p  1 MPTTNITRIMRCVVPDHVKIADDAKEAIQVCVSEFINFITAEANNRCHRDYRKTVTPEDVLAAMMSLGFGDYIEPLIVFLNKHRAQ 86
                      799********************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.77E-301100IPR009072Histone-fold
Gene3DG3DSA:1.10.20.107.0E-37195IPR009072Histone-fold
PfamPF008083.1E-20164IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.0E-112846No hitNo description
PRINTSPR006152.0E-114765No hitNo description
PRINTSPR006152.0E-116684No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MPTTNITRIM RCVVPDHVKI ADDAKEAIQV CVSEFINFIT AEANNRCHRD YRKTVTPEDV  60
LAAMMSLGFG DYIEPLIVFL NKHRAQQDLE RGSMNQLGQF VRRDDDNGCF PQGAHMVRSP  120
PAPAPPAAPT MGYYVPLQPP VAGTVEDGEE LGGSTRAINA YMSCNYGRGE GSSDGPEFDP  180
FYKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A8e-29184992NF-YB
4awl_B9e-291841093NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A9e-291841093NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012852535.11e-117PREDICTED: nuclear transcription factor Y subunit beta-like
SwissprotQ9SFD86e-34NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
SwissprotQ84W667e-34NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A022R6771e-118A0A022R677_ERYGU; Uncharacterized protein (Fragment)
STRINGVIT_19s0015g00580.t012e-34(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.23e-35nuclear factor Y, subunit B6